PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_11503A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 281aa    MW: 31020.2 Da    PI: 6.2557
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_11503AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92.1e-172067148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg+W++eEdell++ v++ G g+W+t +r+ g+ R++k+c++rw +yl
  Oropetium_20150105_11503A 20 RGPWSPEEDELLKRFVAREGEGRWRTLPRRAGLLRCGKSCRLRWMNYL 67
                               89******************************99************97 PP

2Myb_DNA-binding47.34.9e-1574117247
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                g+  ++E++l+v+++++lG++ W++Ia +++ gRt++++k++w+++
  Oropetium_20150105_11503A  74 GPIAADEEDLIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSH 117
                                566689***************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4221567IPR017930Myb domain
SuperFamilySSF466891.2E-2818114IPR009057Homeodomain-like
SMARTSM007171.9E-131969IPR001005SANT/Myb domain
PfamPF002493.0E-152067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-222174IPR009057Homeodomain-like
CDDcd001673.24E-112267No hitNo description
PROSITE profilePS5129424.77368122IPR017930Myb domain
SMARTSM007171.8E-1372120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2475123IPR009057Homeodomain-like
PfamPF002493.5E-1377117IPR001005SANT/Myb domain
CDDcd001671.45E-1078118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MRKQAARAQQ RGGTEPALKR GPWSPEEDEL LKRFVAREGE GRWRTLPRRA GLLRCGKSCR  60
LRWMNYLRPN IKRGPIAADE EDLIVRLHRL LGNRWSLIAG RLPGRTDNEI KNYWNSHISK  120
KLVAQGIDPR THKPLNAAQS SSNGAAATAA ADDNTTKPXX XXXXXXXXXX XXXXXXXXXX  180
XXXGAGVNIA GDDGGSAAFA TAVMDLDDGA DGFEGFCDEF RAWDDAPRGG FDWGCPVVDD  240
VDDGTFSSFL DSLINDDHQF VHYFGDHKNA DGDDKDQGGR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25161223108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1082591e-127AK108259.1 Oryza sativa Japonica Group cDNA clone:002-141-A12, full insert sequence.
GenBankD886201e-127D88620.1 Oryza sativa mRNA for OSMYB4, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656780.15e-98PREDICTED: transcription repressor MYB5-like
TrEMBLK7V4P05e-98K7V4P0_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G395672_P011e-97(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.12e-70myb domain protein 5